LL-37: Pioneering Antimicrobial Peptide for Research

Advance Your Immunology Studies with LL-37

LL-37

LL-37, a cathelicidin-derived antimicrobial peptide, has emerged as a crucial focus in immunology and microbiology research. This multifunctional peptide offers exciting possibilities for studying innate immune responses and novel antimicrobial strategies.

LL-37 Specifications:

Sequence: [LL-37, 37 aa]
Molecular Weight: 4493.33 g/mol
Purity: >95%
Available in 10mg vials

Research Applications:

Antimicrobial mechanism studies
Innate immunity investigations
Wound healing research
Anti-biofilm activity analysis

How to Buy LL-37 Online

Acquiring high-quality LL-37 for your research is straightforward:

Visit our LL-37 product page
Select the 10mg option
Proceed through our secure checkout process.

Why Source LL-37 From Us?

Rigorous quality control ensures consistent purity
Comprehensive documentation, including certificates of analysis
Competitive pricing for research budgets
Prompt, discreet shipping to research facilities worldwide

Expand Your Research Horizons

Incorporate LL-37 into your studies to explore its diverse biological activities. Whether you’re investigating antimicrobial resistance, wound healing processes, or immune modulation, LL-37 offers a versatile tool for cutting-edge research. To buy LL-37 10mg or inquire about bulk orders, please contact our dedicated research support team. We’re committed to supporting your groundbreaking work in immunology and microbiology. Important: LL-37 is intended for research use only. Not for diagnostic, therapeutic, or human use. Elevate your antimicrobial peptide research – purchase LL-37 through our trusted platform today.