Buy LL-37 Peptide Online

LL-37: Pioneering Antimicrobial Peptide for Research

Advance Your Immunology Studies with LL-37

LL-37

LL-37, a cathelicidin-derived antimicrobial peptide, has emerged as a crucial focus in immunology and microbiology research. This multifunctional peptide offers exciting possibilities for studying innate immune responses and novel antimicrobial strategies.

LL-37 Specifications:

• Sequence: [LL-37, 37 aa]
• Molecular Weight: 4493.33 g/mol
• Purity: >95%
• Available in 10mg vials

Research Applications:

• Antimicrobial mechanism studies
• Innate immunity investigations
• Wound healing research
• Anti-biofilm activity analysis

How to Buy LL-37 Online

Acquiring high-quality LL-37 for your research is straightforward:

1. Visit our LL-37 product page
2. Select the 10mg option
3. Proceed through our secure checkout process.

Why Source LL-37 From Us?

• Rigorous quality control ensures consistent purity
• Comprehensive documentation, including certificates of analysis
• Competitive pricing for research budgets
• Prompt, discreet shipping to research facilities worldwide

Expand Your Research Horizons

Incorporate LL-37 into your studies to explore its diverse biological activities. Whether you’re investigating antimicrobial resistance, wound healing processes, or immune modulation, LL-37 offers a versatile tool for cutting-edge research. To buy LL-37 10mg or inquire about bulk orders, please contact our dedicated research support team. We’re committed to supporting your groundbreaking work in immunology and microbiology. Important: LL-37 is intended for research use only. Not for diagnostic, therapeutic, or human use. Elevate your antimicrobial peptide research – purchase LL-37 through our trusted platform today.

LL-37 Peptide: Frequently Asked Questions (FAQs)

1. What is LL-37?

LL-37 is the only human cathelicidin antimicrobial peptide, derived from the precursor protein hCAP18. It plays a crucial role in the innate immune system by exhibiting broad-spectrum antimicrobial activity against bacteria, viruses, and fungi. Additionally, LL-37 is involved in modulating immune responses and promoting wound healing.

2. How does LL-37 function in the immune system?

LL-37 contributes to host defense by:

• Disrupting microbial membranes, leading to pathogen death.

• Neutralizing bacterial endotoxins.

• Modulating inflammatory responses by interacting with immune receptors.

• Promoting chemotaxis of immune cells to infection sites.

3. What are the potential therapeutic applications of LL-37?

Due to its antimicrobial and immunomodulatory properties, LL-37 is being explored for therapeutic use in:

• Treating antibiotic-resistant infections.

• Enhancing wound healing and tissue regeneration.

• Managing inflammatory skin conditions like psoriasis and eczema.

• Potentially modulating immune responses in autoimmune diseases.

4. Are there any known side effects or risks associated with LL-37?

While LL-37 has beneficial roles, its overexpression or dysregulation may contribute to:

• Chronic inflammatory conditions.

• Autoimmune diseases, such as systemic lupus erythematosus and rheumatoid arthritis.

However, there are currently no reported cases of exogenous LL-37 administration causing such diseases.

5. How is LL-37 production regulated in the body?

LL-37 expression is upregulated by:

• Vitamin D: Enhances LL-37 gene expression in various cells.

• Toll-like receptor activation: Stimulates LL-37 production in response to microbial components.

6. Is LL-37 available for clinical use?

Currently, LL-37 is primarily utilized in research settings. Clinical applications are under investigation, and it is not yet approved for widespread therapeutic use.

7. Can LL-37 be used as an alternative to traditional antibiotics?

LL-37 exhibits antimicrobial activity against various pathogens, including antibiotic-resistant strains. However, its clinical efficacy and safety as an antibiotic alternative are still under research.

8. How does LL-37 contribute to wound healing?

LL-37 promotes wound healing by:

• Stimulating cell proliferation and migration.

• Enhancing angiogenesis (formation of new blood vessels).

• Modulating inflammatory responses to facilitate tissue repair.

9. Are there synthetic analogs of LL-37 being developed?

Yes, researchers are developing synthetic derivatives of LL-37 with enhanced stability and antimicrobial activity, aiming to overcome limitations associated with natural peptides.

10. Where can I find more information about LL-37?

For detailed scientific information, you can refer to: PeptideNationUSA